ACRV1 Antibody - N-terminal region : Biotin

ACRV1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP53590_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: ACRV1 is a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans. This gene encodes a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. This gene consists of 4 exons and its alternative splicing generates multiple distinct transcripts, which encode protein isoforms ranging from 81 to 265 amino acids. The longest transcript is the most abundant, comprising 53-72% of the total acrosomal vesicle protein 1 messages; the second largest transcript comprises 15-32%; the third and the fourth largest transcripts account for 3.4-8.3% and 8.7-12.5%, respectively; and the remaining transcripts combined account for < 1% of the total acrosomal vesicle protein 1 message. It is suggested that phenomena of cryptic splicing and exon skipping occur within this gene. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACRV1

Key Reference: Reddi,P.P., J. Reprod. Immunol. 53 (1-2), 25-36 (2002)

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Acrosomal protein SP-10

Protein Size: 265

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53590_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53590_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rabbit, Guinea Pig
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 56
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×