ACSBG2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ACSBG2 belongs to the ATP-dependent AMP-binding enzyme family, bubblegum subfamily.ACSBG2 mediates activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. It is able to activate long-chain fatty acids. Also able to activate very long-chain fatty acids; however, the relevance of such activity is unclear in vivo. ACSBG2 has increased ability to activate oleic and linoleic acid. It may play a role in spermatogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACSBG2

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: LNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILTGCK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Long-chain-fatty-acid--CoA ligase ACSBG2

Protein Size: 616

Purification: Affinity Purified

• Artikelnummer: AVIARP53793_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53793_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 81616
• Wirt: Rabbit
• Konjugat: Conjugated, FITC