Tau (K18) Delta K280 Mutant Monomers

Human Recombinant Tau (K18) Delta K280 Mutant Protein Monomers
Artikelnummer
STRSPR-476B
Verpackungseinheit
100 µg
Hersteller
Stressmarq Biosciences

Verfügbarkeit: wird geladen...
Preis wird geladen...
Target: Tau (K18) Delta K280 Mutant

Nature: Recombinant

Swiss-Prot: P10636

Expression System: E. coli

Protein Length: Partial

Amino Acid Sequence: MSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE

Purification: Ion-exchange Purified

Purity: >95%

Storage Buffer: PBS pH 7.4

Protein Size: ~15 kDa

Conjugate: No Tag

Cellular Localization: Cytoplasm / Axolemma / Axolemma Plasma Membrane / Axon / Cell Body / Cell membrane / Cytoplasmic Ribonucleoprotein Granule / Cytoplasmic Side / Cytoskeleton / Cytosol / Dendrite / Growth cone / Microtubule / Microtubule Associated Complex / Neurofibrillary Tangle / Neuronal Cell Body / Nuclear Periphery / Nuclear Speck / Nucleus / Peripheral membrane protein / Plasma Membrane / Tubulin Complex

Scientific Background: Alzheimer’s Disease (AD) is the most common neurodegenerative disease, affecting 10% of seniors over the age of 65 (1). It was named after Alois Alzheimer, a German scientist who discovered tangled bundles of fibrils where neurons had once been in the brain of a deceased patient in 1907 (2). Tau (tubulin-associated unit) is normally located in the axons of neurons where it stabilizes microtubules. Tauopathies such as AD are characterized by neurofibrillary tangles containing hyperphosphorylated tau fibrils (3). The ΔK280 mutation is associated with frontotemporal dementia and promotes fibrillization into paired helical filaments (PHFs) in the absence of heparin and other inducers (4). K18 is a truncated form of human tau containing only the 4 microtubule binding repeats (5).

References: 1. www.alz.org/alzheimers-dementia/facts-figures2. Alzheimer, A. Über eine eigenartige Erkrankung der Hirnrinde. Allg. Z. Psychiatr. Psych.-Gerichtl. Med. 64, 146–148 (1907)3. Matsumoto, G. et al. (2018). Int J Mol Sci. 19, 1497.4.Von Bergen, M. et al. (2001). J Biol Chem. 276(51):48165-48174.5. Guo, J. and Lee, M.Y. (2013). FEBS Lett. 587(6): 717-723.

Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
Mehr Informationen
Artikelnummer STRSPR-476B
Hersteller Stressmarq Biosciences
Hersteller Artikelnummer SPR-476B
Verpackungseinheit 100 µg
Mengeneinheit STK
Reaktivität Human
Methode Western Blotting, In Vivo Assay, SDS-PAGE
Human Gene ID 4137
Produktinformation (PDF)
×
MSDS (PDF) Download