ACTL6B Antibody - middle region : HRP

ACTL6B Antibody - middle region : HRP
Artikelnummer
AVIARP56847_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feat

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACTL6B

Key Reference: Oma,Y., (2003) Biochem. Biophys. Res. Commun. 301 (2), 521-528

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: GHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Actin-like protein 6B

Protein Size: 426

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56847_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56847_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51412
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×