Actl7a Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Actl7a

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: VVPIYEGYPLPSITGRLDYAGSDLTTYLMNLMNNSGKHFSEDHLGIVEDI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Actin-like protein 7A

Protein Size: 440

Purification: Affinity Purified

• Artikelnummer: AVIARP53663_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53663_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 11470
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin