ADAM2 Antibody - middle region : Biotin

ADAM2 Antibody - middle region : Biotin
Artikelnummer
AVIARP53589_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: ADAM2 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM2 is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADAM2

Key Reference: Eto,K., (2002) J. Biol. Chem. 277 (20), 17804-17810

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVIL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Disintegrin and metalloproteinase domain-containing protein 2

Protein Size: 735

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53589_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53589_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2515
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×