ADAM2 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ADAM2 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM2 is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: NFDSLPVQITVPEKIRSIIKEGIESQASYKIVIEGKPYTVNLMQKNFLPH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Disintegrin and metalloproteinase domain-containing protein 2

Protein Size: 735

Purification: Affinity Purified

• Artikelnummer: AVIARP53588_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53588_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Pig (Porcine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2515
• Wirt: Rabbit
• Konjugat: Conjugated, HRP