ADAMDEC1 Antibody - middle region : Biotin

ADAMDEC1 Antibody - middle region : Biotin
Artikelnummer
AVIARP55070_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation. This protein may play an important role in dendritic cell function and their i

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADAMDEC1

Key Reference: 0

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: GMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ADAM DEC1

Protein Size: 470

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55070_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55070_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27299
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×