ADAMDEC1 Antibody - middle region : HRP

ADAMDEC1 Antibody - middle region : HRP
Artikelnummer
AVIARP55070_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation. This protein may play an important role in dendritic cell function and their i

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADAMDEC1

Key Reference: 0

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: GMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: ADAM DEC1

Protein Size: 470

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55070_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55070_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27299
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×