ADO Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Human thiol dioxygenases include cysteine dioxygenase (CDO; MIM 603943) and cysteamine (2-aminoethanethiol) dioxygenase (ADO; EC 1.13.11.19). CDO adds 2 oxygen atoms to free cysteine, whereas ADO adds 2 oxygen atoms to free cysteamine to form hypotaurine (Dominy et al., 2007 [PubMed 17581819]).[supplied by OMIM, Mar 2008]

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human AEDO

Key Reference: N/A

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: VRPGVLRSRAEYTEASGPCILTPHRDNLHQIDAVEGPAAFLDILAPPYDP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 2-aminoethanethiol dioxygenase

Protein Size: 270

Purification: Affinity purified

• Artikelnummer: AVIARP53811_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53811_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 84890
• Wirt: Rabbit
• Konjugat: Conjugated, HRP