AFAP1 Antibody - N-terminal region : FITC

AFAP1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57551_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a Src binding partner. It may represent a potential modulator of actin filament integrity in response to cellular signals, and may function as an adaptor protein by linking Src family members and/or other signaling proteins to actin filaments. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human AFAP1

Key Reference: N/A

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: QWLKVIKEAYSGCSGPVDSECPPPPSSPVHKAELEKKLSSERPSSDGEGV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 730

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP57551_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57551_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 60312
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×