AGBL5 Antibody - C-terminal region : FITC

AGBL5 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP53752_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: AGBL5 belongs to the peptidase M14 family. The exact function of AGBL5 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human AGBL5

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytosolic carboxypeptidase-like protein 5

Protein Size: 427

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53752_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53752_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 60509
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×