AGBL5 Antibody - C-terminal region : HRP

AGBL5 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP53752_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: AGBL5 belongs to the peptidase M14 family. The exact function of AGBL5 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human AGBL5

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cytosolic carboxypeptidase-like protein 5

Protein Size: 427

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53752_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53752_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 60509
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×