AGGF1 Antibody - middle region : Biotin

AGGF1 Antibody - middle region : Biotin
Artikelnummer
AVIARP57098_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The AGGF1 gene encodes a potent angiogenic factor that contains a forkhead-associated domain and a G-patch domain (Tian et al., 2004 [PubMed 14961121]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AGGF1

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: EYEDEKTLKNPKYKDRAGKRREQVGSEGTFQRDDAPASVHSEITDSNKGR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Angiogenic factor with G patch and FHA domains 1

Protein Size: 714

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57098_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57098_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55109
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×