AGK Antibody - N-terminal region : FITC

AGK Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57170_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: AGK is a lipid kinase that can phosphorylate both monoacylglycerol and diacylglycerol to form lysophosphatidic acid (LPA) and phosphatidic acid (PA), respectively. AGK does not phosphorylate sphingosine. Overexpression of AGK increases the formation and secretion of LPA, resulting in transactivation of EGFR and activation of the downstream MAPK signaling pathway, leading to increased cell growth.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AGK

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: KKLLELMENTDVIIVAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Acylglycerol kinase, mitochondrial

Protein Size: 422

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57170_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57170_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55750
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×