Agtpbp1 Antibody - C-terminal region : HRP

Agtpbp1 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP55206_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Agtpbp1 is a metallocarboxypeptidase that mediates deglutamylation of target proteins. It catalyzes the deglutamylation of polyglutamate side chains generated by post-translational polyglutamylation in proteins such as tubulins. It also removes gene-encoded polyglutamates from the carboxy-terminus of target proteins such as MYLK. Agtpbp1 acts as a long-chain deglutamylase and specifically shortens long polyglutamate chains, while it is not able to remove the branching point glutamate, a process catalyzed by AGBL5/CCP5. Deglutamylation plays a key role in cerebellar Purkinje cell differentiation, accumulation of tubulin polyglutamylation causing neurodegeneration.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Agtpbp1

Molecular Weight: 128kDa

Peptide Sequence: Synthetic peptide located within the following region: GMQPLMYSVQEALNARPWWIRMGTDICYYKNHFSRSSVAAGGQKGKSYYT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Size: 1160

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55206_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55206_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 67269
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×