AGTPBP1 Antibody - N-terminal region : FITC

AGTPBP1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55205_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NNA1 is a zinc carboxypeptidase that contains nuclear localization signals and an ATP/GTP-binding motif that was initially cloned from regenerating spinal cord neurons of the mouse.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AGTPBP1

Molecular Weight: 134kDa

Peptide Sequence: Synthetic peptide located within the following region: KAFIDANGMKILYNTSQLPVIPVTGPVAQLYSLPPEVDDVVDESDDNDDI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytosolic carboxypeptidase 1

Protein Size: 1186

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55205_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55205_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23287
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×