AIP Antibody - middle region : Biotin

AIP Antibody - middle region : Biotin
Artikelnummer
AVIARP58131_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a receptor for aryl hydrocarbons and a ligand-activated transcription factor. The encoded protein is found in the cytoplasm as part of a multiprotein complex, but upon binding of ligand is transported to the nucleus. This protein can regulate the expression of many xenobiotic metabolizing enzymes. Also, the encoded protein can bind specifically to and inhibit the activity of hepatitis B virus.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AIP

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: NAQEAQADFAKVLELDPALAPVVSRELQALEARIRQKDEEDKARFRGIFS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: AH receptor-interacting protein

Protein Size: 330

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58131_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58131_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 9049
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×