AIP Antibody - N-terminal region : HRP

AIP Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58132_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: AIP may play a positive role in AHR-mediated signalling possibly by influencing its receptivity for ligand and/or its nuclear targeting. AIP is the cellular negative regulator of the HBV X protein. AIP may play a positive role in AHR-mediated signalling possibly by influencing its receptivity for ligand and/or its nuclear targeting. AIP is the cellular negative regulator of the HBV X protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AIP

Key Reference: Buchbinder,S., (er) Exp. Clin. Endocrinol. Diabetes (2008) In press

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: FHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKLPVWETIVCTMREGEI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: AH receptor-interacting protein

Protein Size: 330

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58132_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58132_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 9049
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×