AKR1C2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AKR1C2

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: DGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Aldo-keto reductase family 1 member C2

Protein Size: 323

Purification: Affinity Purified

• Artikelnummer: AVIARP53507_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53507_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 1646
• Wirt: Rabbit
• Konjugat: Conjugated, FITC