ALLC Antibody - N-terminal region : Biotin

ALLC Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57249_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Allantoicase (EC 3.5.3.4) participates in the uric acid degradation pathway. Its enzymatic activity, like that of urate oxidase (MIM 191540), was lost during vertebrate evolution.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ALLC

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: VIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Allantoicase, isoform CRA_a EMBL EAX01050.1

Protein Size: 391

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57249_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57249_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55821
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×