ALOX12 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ALOX12 belongs to the lipoxygenase family. It contains 1 lipoxygenase domain and 1 PLAT domain. It has oxygenase and 14,15-leukotriene A4 synthase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ALOX12

Key Reference: Guimaraes,P.E., (er) Spinal Cord (2008) In press

Molecular Weight: 76kDa

Peptide Sequence: Synthetic peptide located within the following region: MGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Arachidonate 12-lipoxygenase, 12S-type

Protein Size: 663

Purification: Affinity Purified

• Artikelnummer: AVIARP54350_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54350_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 239
• Wirt: Rabbit
• Konjugat: Conjugated, FITC