ALOX15 Antibody - middle region : FITC

ALOX15 Antibody - middle region : FITC
Artikelnummer
AVIARP56030_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ALOX15 converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid. ALOX15 also acts on C-12 of arachidonate as well as on linoleic acid.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ALOX15

Key Reference: McCaskie,P.A., (2008) Hum. Genet. 123 (5), 445-453

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Arachidonate 15-lipoxygenase

Protein Size: 662

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56030_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56030_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 246
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×