ALOX15 Antibody - middle region : HRP

ALOX15 Antibody - middle region : HRP
Artikelnummer
AVIARP56030_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ALOX15 converts arachidonic acid to 15S-hydroperoxyeicosatetraenoic acid. ALOX15 also acts on C-12 of arachidonate as well as on linoleic acid.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ALOX15

Key Reference: McCaskie,P.A., (2008) Hum. Genet. 123 (5), 445-453

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Arachidonate 15-lipoxygenase

Protein Size: 662

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56030_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56030_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 246
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×