AMELY Antibody - C-terminal region : FITC

AMELY Antibody - C-terminal region : FITC
Artikelnummer
AVIARP54565_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in a related gene on chromosome X cause X-linked amelogenesis imperfecta.

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: QPMQPQPPVQPMQPLLPQPPLPPMFPLRPLPPILPDLHLEAWPATDKTKQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Amelogenin, Y isoform

Protein Size: 192

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54565_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54565_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Dog (Canine), Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 266
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×