Amigo2 Antibody - middle region : HRP

Amigo2 Antibody - middle region : HRP
Artikelnummer
AVIARP55810_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Amigo2 is required for depolarization-dependent survival of cultured cerebellar granule neurons. It may mediate homophilic as well as heterophilic cell-cell interaction with AMIGO1 or AMIGO3. It also may contribute to signal transduction through its intracellular domain.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: FHALGFIHEAQVGERAIVHCDGKTGNGNTDFIWVGPDNRLLEPDKDTGNF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Amphoterin-induced protein 2

Protein Size: 520

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55810_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55810_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 300186
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×