AMIGO2 Antibody - N-terminal region : FITC

AMIGO2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55809_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: AMIGO2 is required for depolarization-dependent survival of cultured cerebellar granule neurons. It may mediate homophilic as well as heterophilic cell-cell interaction with AMIGO1 or AMIGO3 abd may contribute to signal transduction through its intracellular domain. It also may be required for tumorigenesis of a subset of gastric adenocarcinomas.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human AMIGO2

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: LSYNRIGLLDSEWIPVSFAKLNTLILRHNNITSISTGSFSTTPNLKCLDL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Amphoterin-induced protein 2

Protein Size: 522

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55809_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55809_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 347902
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×