AMPH Antibody - N-terminal region : FITC

AMPH Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55434_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: AMPH is a protein associated with the cytoplasmic surface of synaptic vesicles. A subset of patients with stiff-man syndrome who were also affected by breast cancer are positive for autoantibodies against this protein.This gene encodes a protein associated with the cytoplasmic surface of synaptic vesicles. A subset of patients with stiff-man syndrome who were also affected by breast cancer are positive for autoantibodies against this protein. Alternate splicing of this gene results in two transcript variants encoding different isoforms. Additional splice variants have been described, but their full length sequences have not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AMPH

Key Reference: Hou,T., (2008) J. Mol. Biol. 376 (4), 1201-1214

Molecular Weight: 76kDa

Peptide Sequence: Synthetic peptide located within the following region: ADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Amphiphysin

Protein Size: 695

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55434_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55434_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 273
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×