Amy1a Antibody - middle region : FITC

Amy1a Antibody - middle region : FITC
Artikelnummer
AVIARP54700_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Amy1a

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: YLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGSSILTFWDARLYKMAV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Alpha-amylase EMBL BAB39466.1

Protein Size: 521

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54700_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54700_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 24203
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×