AMZ2 Antibody - C-terminal region : Biotin

AMZ2 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP56248_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of AMZ2 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human AMZ2

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: ACLMQGSNHLEEADRRPLNLCPICLHKLQCAVGFSIVERYKALVRWIDDE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Archaemetzincin-2 Ensembl ENSP00000352831

Protein Size: 302

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56248_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56248_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51321
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×