Amz2 Antibody - middle region : Biotin

Amz2 Antibody - middle region : Biotin
Artikelnummer
AVIARP56247_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Amz2 is Zinc metalloprotease. It exhibits activity against angiotensin-3 in vitro and does not hydrolyze neurogranin nor angiotensin-2.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Amz2

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: ITLHSQSDWISSHPEAPQDFEQFFSDRYRKAPCPKKHIIYIQPIGFLGNT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Archaemetzincin-2

Protein Size: 359

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56247_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56247_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 360650
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×