Amz2 Antibody - middle region : HRP

Amz2 Antibody - middle region : HRP
Artikelnummer
AVIARP56247_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Amz2 is Zinc metalloprotease. It exhibits activity against angiotensin-3 in vitro and does not hydrolyze neurogranin nor angiotensin-2.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Amz2

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: ITLHSQSDWISSHPEAPQDFEQFFSDRYRKAPCPKKHIIYIQPIGFLGNT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Archaemetzincin-2

Protein Size: 359

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56247_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56247_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 360650
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×