ANGPT4 Antibody - N-terminal region : HRP

ANGPT4 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56798_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Angiopoietins are proteins with important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-protein kinase receptor. The mechanism by which they contribute to angiogenesis

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANGPT4

Key Reference: Nakayama,T., (2007) World J. Gastroenterol. 13 (33), 4473-4479

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: TLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Angiopoietin-4

Protein Size: 503

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56798_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56798_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51378
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×