ANGPTL2 Antibody - middle region : FITC

ANGPTL2 Antibody - middle region : FITC
Artikelnummer
AVIARP54836_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. ANGPTL2 protein is a secreted glycoprotein with homology to the angiopoietins and may exert a function on endothelial cells through autocrine or paracrine action.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ANGL2

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: PPAAPPRVYQPPTYNRIINQISTNEIQSDQNLKVLPPPLPTMPTLTSLPS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: angiopoietin-related protein 2

Protein Size: 493

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP54836_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54836_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23452
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×