ANGPTL5 Antibody - N-terminal region : FITC

ANGPTL5 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55766_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact functions of ANGPTL5 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANGPTL5

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: ASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Angiopoietin-related protein 5

Protein Size: 388

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55766_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55766_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 253935
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×