ANKRD37 Antibody - middle region : Biotin

ANKRD37 Antibody - middle region : Biotin
Artikelnummer
AVIARP55804_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ANKRD37

Key Reference: Li,J., (2005) Cell. Mol. Biol. Lett. 10 (1), 185-193

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: GFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ankyrin repeat domain-containing protein 37

Protein Size: 158

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55804_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55804_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Dog (Canine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 353322
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×