ANKRD39 Antibody - N-terminal region : FITC

ANKRD39 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56912_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of ANKRD39 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANKRD39

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: IWSAALNGDLGRVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ankyrin repeat domain-containing protein 39

Protein Size: 183

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56912_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56912_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51239
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×