Ankrd46 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE Ankrd46

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: FRTTWQEFVEDLGFWRVLLLILVIALLSLGIAYYVSGVLPFVDNQPELVH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ankyrin repeat domain-containing protein 46

Protein Size: 228

Purification: Affinity Purified

• Artikelnummer: AVIARP53464_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53464_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 68839
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin