ANKRD7 Antibody - middle region : FITC

ANKRD7 Antibody - middle region : FITC
Artikelnummer
AVIARP53739_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ANKRD7 contains 5 ANK repeats. The exact function of ANKRD7 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ANKRD7

Key Reference: Ozaki,K., (1996) Genomics 36 (2), 316-319

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: EYEADLEAKNKDGYTPLLVAVINNNPKMVKFLLEKGADVNASDNYQRTAL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ankyrin repeat domain-containing protein 7

Protein Size: 151

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53739_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53739_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 56311
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×