ANKRD7 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ANKRD7 contains 5 ANK repeats. The exact function of ANKRD7 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ANKRD7

Key Reference: Ozaki,K., (1996) Genomics 36 (2), 316-319

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: EYEADLEAKNKDGYTPLLVAVINNNPKMVKFLLEKGADVNASDNYQRTAL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ankyrin repeat domain-containing protein 7

Protein Size: 151

Purification: Affinity Purified

• Artikelnummer: AVIARP53739_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53739_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 56311
• Wirt: Rabbit
• Konjugat: Conjugated, HRP