Anks1 Antibody - C-terminal region : Biotin

Anks1 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP55208_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Anks1 may play a negative role in growth factor receptor signaling pathways.

Molecular Weight: 127kDa

Peptide Sequence: Synthetic peptide located within the following region: NLWELELVNVLKVHLLGHRKRIIASLADRPYEEPPQKPPRFSQLRCQDLI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: COP9 signalosome complex subunit 4

Protein Size: 1150

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55208_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55208_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Immunoprecipitation, Western Blotting
Human Gene ID 224650
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×