Anks1 Antibody - C-terminal region : HRP

Anks1 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP55208_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Anks1 may play a negative role in growth factor receptor signaling pathways.

Molecular Weight: 127kDa

Peptide Sequence: Synthetic peptide located within the following region: NLWELELVNVLKVHLLGHRKRIIASLADRPYEEPPQKPPRFSQLRCQDLI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: COP9 signalosome complex subunit 4

Protein Size: 1150

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55208_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55208_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Immunoprecipitation, Western Blotting
Human Gene ID 224650
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×