Anti-AGGF1

angiogenic factor with G patch and FHA domains 1, Polyclonal, IgG, Rabbit

GeneName: AGGF1

Concentration: 0,5

Sequence: VEELSKILQRGRNEDNKKSDVEVQTENHAPWSISDYFYQTYYNDVSLPNKVTELSDQQDQAIETSILNSKDHLQVENDAYPGTDRTENVKYRQVDHFASNSQEPA

InterspeciesReactivity: ENSMUSG00000021681: 58%, ENSRNOG00000029304: 57%

Entrez Gene ID: 55109

Uniprot ID: Q8N302

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal AGGF1 Antibody against Human angiogenic factor with G-patch and FHA domains 1. Validated for Western Blot

• Artikelnummer: ATLHPA037644-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA037644-100
• Verpackungseinheit: 100UL
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 55109
• Wirt: Rabbit
• Konjugat: Unconjugated