Anti-ANKDD1B

ankyrin repeat and death domain containing 1B, Polyclonal, IgG, Rabbit

GeneName: ANKDD1B

Concentration: 0,05

Sequence: ATQSNHVRIVEYLIQDLHLKDLNQPDEKGRKPFLLAAERGHVEMIEKLTFLNLHTSE

InterspeciesReactivity: ENSMUSG00000047117: 79%, ENSRNOG00000025377: 81%

Entrez Gene ID: 728780

Uniprot ID: A6NHY2

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal ANKDD1B Antibody against Human ankyrin repeat and death domain containing 1B. Validated for Western Blot

• Artikelnummer: ATLHPA040227-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA040227-100
• Verpackungseinheit: 100UL
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 728780
• Wirt: Rabbit
• Konjugat: Unconjugated