Anti-ApoA1 (D11-6)

Anti-ApoA1 [D11-6], Recombinant, IgG1 kappa, Human
Artikelnummer
ABAAb03979-10.3-BT
Verpackungseinheit
1 mg
Hersteller
Absolute Antibody

Verfügbarkeit: wird geladen...
Preis wird geladen...
CloneID: D11-6

Heavy Chain modification: Fc Silent™

Antigen Long Description: The original antibody was generated by immunizing BALB/c mice with human ApoA1.

Buffer Composition: PBS only.

Chimeric Use Statement: This is a reformatted human IgG1 Fc Silent™ antibody, based on the original human IgG2a format, created for improved compatibility with existing reagents, assays and techniques.

Uniprot Accession No.: P02647

Specificity Statement: The antibody is specific for ApoA1. The antibody recognizes the epitope exposed by the ApoA1 protein on an HDL subclass significantly positively correlated with CHD, and the recognition epitope is determined on a polypeptide sequence comprising 41 amino acids (LGEEMRDRRAHVDALRTHLAPYSDELRQRLAARLEALKEN). The antibody does not react with HSA and the recombinant protein SAA1. Apolipoprotein A1 (ApoA1) is the main structural protein of high-density lipoprotein (HDL), and its physiological function is to help HDL capture free cholesterol.

Application Notes (Clone): The specificity of the antibody for ApoA1 protein was confirmed by ELISA analysis. The binding affinity of the antibody was 9.6×10^-10 M. The antibody was employed for detection of APOA1. The antibody could identify a possible pathogenic HDL subtype, and the detection result was positively correlated with CHD. Further, the detection results of the kit developed by the antibody had high consistency with the clinical diagnosis results (CN113265002A).
Mehr Informationen
Artikelnummer ABAAb03979-10.3-BT
Hersteller Absolute Antibody
Hersteller Artikelnummer Ab03979-10.3-BT
Verpackungseinheit 1 mg
Mengeneinheit STK
Reaktivität Human
Klonalität Recombinant
Methode ELISA
Isotyp IgG1 kappa
Wirt Human
Produktinformation (PDF) Download
MSDS (PDF) Download