Anti-ASB1

ankyrin repeat and SOCS box containing 1, Polyclonal, IgG, Rabbit

GeneName: ASB1

Concentration: 0,05

Sequence: WLREQFCDHPLEHCEDTRLHDAAYVGDLQTLRSLLQEESYRSRINEKSVWCCGWLPCTPLRIAATAGHGSCVDFLI

InterspeciesReactivity: ENSMUSG00000026311: 96%, ENSRNOG00000020322: 97%

Entrez Gene ID: 51665

Uniprot ID: Q9Y576

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Long Description: Rabbit Polyclonal ASB1 Antibody against Human ankyrin repeat and SOCS box containing 1. Validated for Western Blot

• Artikelnummer: ATLHPA075395-100
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA075395-100
• Verpackungseinheit: 100UL
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 51665
• Wirt: Rabbit
• Konjugat: Unconjugated