Anti-CABLES1

Cdk5 and Abl enzyme substrate 1, Polyclonal, IgG, Rabbit

Sequence: SRGRLNSFTQGILPIAFSRPTSQNYCSLEQPGQGGSTSAFEQLQRSRRRLISQRSSLETLEDIEENAPLRRCRTLSGSPRPKN

GeneName: CABLES1

Ensembl Gene ID: ENSG00000134508

UniProt ID: Q8TDN4

Entrez Gene ID: 91768

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Concentration: 0.1

Interspecies Mouse/Rat: ENSMUSG00000040957: 94%, ENSRNOG00000012795: 92%

Enhanced Validation: No

• Artikelnummer: ATLHPA073649-25
• Hersteller: Atlas Antibodies
• Hersteller Artikelnummer: HPA073649-25
• Verpackungseinheit: 25 µl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Immunocytochemistry
• Isotyp: IgG
• Human Gene ID: 91768
• Wirt: Rabbit
• Konjugat: Unconjugated