Anti-Caspase-3 (4F-6)

Anti-Caspase-3 [4F-6], Recombinant, IgG1 kappa, Mouse
Artikelnummer
ABAAb04219-1.1-BT
Verpackungseinheit
1 mg
Hersteller
Absolute Antibody

Verfügbarkeit: wird geladen...
Preis wird geladen...
CloneID: 4F-6

Antigen Long Description: The original antibody was generated by immunizing BALB/c mice with the antigenic peptide sequence NGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDC.

Buffer Composition: PBS only.

Uniprot Accession No.: P42574

Specificity Statement: The antibody is specific for Caspase-3. The antibody does not cross react with Caspase-7, Caspase-8, GST and BSA.

Application Notes (Clone): The specificity of the original format of the antibody was confirmed by ELISA analysis (EC50= 0.09956μg/mL). The antibody detected Caspase-3 by western blot analysis. The original format of the antibody could inhibit the activity of Caspase-3 protein in cells, inhibit cell apoptosis, and prolong the cryopreservation of the cells cycle (CN116270413A).
Mehr Informationen
Artikelnummer ABAAb04219-1.1-BT
Hersteller Absolute Antibody
Hersteller Artikelnummer Ab04219-1.1-BT
Verpackungseinheit 1 mg
Mengeneinheit STK
Reaktivität Human
Klonalität Recombinant
Methode Western Blotting, ELISA, Inhibition
Isotyp IgG1 kappa
Wirt Mouse
Produktinformation (PDF) Download
MSDS (PDF) Download