CloneID: RV-Gn3
Antigen Long Description: The original antibody was raised by immunizing a rabbit with the full-length RVFV Gn ectodomain.
Buffer Composition: PBS with 0.02% Proclin 300.
Available Custom Conjugation Options: AP, HRP, Fluorescein, APC, PE, Biotin Type A, Biotin Type B, Streptavidin, FluoroProbes 647H, Atto488, APC/Cy7, PE/Cy7
Uniprot Accession No.: A2T080
Specificity Statement: This antibody is specific for the sequence SQCPKIGGHGSKKCTGDAAFCSAYECTAQYAN of glycoprotein N from Rift valley fever virus.
Application Notes (Clone): The original antibody was used for an ELISA on glycoprotein N from Rift valley fever virus. This antibody has also shown the ability to neutralize Rift valley fever virus in a plaque reduction assay. The structure of the original antibody was determined using x-ray crystallography (Allen et al., 2018; PMID:30590046).
Deutsch
English
