Anti-Envelopment polyprotein (RV-Gn3)

Anti-Envelopment polyprotein [RV-Gn3], Recombinant, IgG kappa, Rabbit

CloneID: RV-Gn3

Antigen Long Description: The original antibody was raised by immunizing a rabbit with the full-length RVFV Gn ectodomain.

Buffer Composition: PBS only.

Uniprot Accession No.: A2T080

Specificity Statement: This antibody is specific for the sequence SQCPKIGGHGSKKCTGDAAFCSAYECTAQYAN of glycoprotein N from Rift valley fever virus.

Application Notes (Clone): The original antibody was used for an ELISA on glycoprotein N from Rift valley fever virus. This antibody has also shown the ability to neutralize Rift valley fever virus in a plaque reduction assay. The structure of the original antibody was determined using x-ray crystallography (Allen et al., 2018; PMID:30590046).

• Artikelnummer: ABAAb04482-23.0-BT
• Hersteller: Absolute Antibody
• Hersteller Artikelnummer: Ab04482-23.0-BT
• Verpackungseinheit: 1 mg
• Mengeneinheit: STK
• Reaktivität: Virus
• Klonalität: Recombinant
• Methode: ELISA, Neutralization, Crystallography
• Isotyp: IgG kappa
• Wirt: Rabbit